General Information

  • ID:  hor006985
  • Uniprot ID:  P23510??2-185)
  • Protein name:  Tumor necrosis factor ligand superfamily member 4
  • Gene name:  EPO
  • Organism:  Homo sapiens
  • Family:  Tumor necrosis factor family
  • Source:  Human
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  NA
  • GO BP:  GO:0005125 cytokine activity; GO:0005102 signaling receptor binding; GO:0005164 tumor necrosis factor receptor binding; GO:0032813 tumor necrosis factor receptor superfamily binding
  • GO CC:  GO:0006955 immune response; GO:0043382 positive regulation of memory T cell differentiation; GO:0002726 positive regulation of T cell cytokine production; GO:0071380 cellular response to prostaglandin E stimulus; GO:0045630 positive regulation of T-helper 2 cell differentiation; GO:0002830 positive regulation of type 2 immune response; GO:0032729 positive regulation of type II interferon production; GO:0002819 regulation of adaptive immune response; GO:0009615 response to virus; GO:0035713 response to nitrogen dioxide; GO:0032755 positive regulation of interleukin-6 production; GO:0007165 signal transduction; GO:0035712 T-helper 2 cell activation; GO:0071222 cellular response to lipopolysaccharide; GO:0002526 acute inflammatory response; GO:0002215 defense response to nematode; GO:0050727 regulation of inflammatory response; GO:2000572 positive regulation of interleukin-4-dependent isotype switching to IgE isotypes; GO:0042102 positive regulation of T cell proliferation; GO:0032736 pos

Sequence Information

  • Sequence:  ERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
  • Length:  182
  • Propeptide:  MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA